Anti FUT11 pAb (ATL-HPA014033)

Atlas Antibodies

SKU:
ATL-HPA014033-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
  • Immunofluorescent staining of human cell line A-431 shows localization to nuclear membrane & the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: fucosyltransferase 11 (alpha (1,3) fucosyltransferase)
Gene Name: FUT11
Alternative Gene Name: MGC33202
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039357: 87%, ENSRNOG00000009274: 89%
Entrez Gene ID: 170384
Uniprot ID: Q495W5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MKYLAYKQPGGITNQFLLDSLKHREWGVNDPLLPNYLNGFECFVCDYELARLDAEKAHAASPGDSPVFEPHIAQPSHMDCPVPTPGFGNVEEIPENDSWKEMWLQDYWQGLDQGEALTAMIHNNETEQTKFWDYL
Gene Sequence MKYLAYKQPGGITNQFLLDSLKHREWGVNDPLLPNYLNGFECFVCDYELARLDAEKAHAASPGDSPVFEPHIAQPSHMDCPVPTPGFGNVEEIPENDSWKEMWLQDYWQGLDQGEALTAMIHNNETEQTKFWDYL
Gene ID - Mouse ENSMUSG00000039357
Gene ID - Rat ENSRNOG00000009274
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FUT11 pAb (ATL-HPA014033)
Datasheet Anti FUT11 pAb (ATL-HPA014033) Datasheet (External Link)
Vendor Page Anti FUT11 pAb (ATL-HPA014033) at Atlas Antibodies

Documents & Links for Anti FUT11 pAb (ATL-HPA014033)
Datasheet Anti FUT11 pAb (ATL-HPA014033) Datasheet (External Link)
Vendor Page Anti FUT11 pAb (ATL-HPA014033)