Anti FUNDC2 pAb (ATL-HPA059129)

Atlas Antibodies

SKU:
ATL-HPA059129-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: FUN14 domain containing 2
Gene Name: FUNDC2
Alternative Gene Name: DC44, HCBP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031198: 75%, ENSRNOG00000024066: 65%
Entrez Gene ID: 65991
Uniprot ID: Q9BWH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAASSQGNFEGDIESVDLAEFAKQQPWWRKLFGPESGLSAEKYSVATHLFIG
Gene Sequence MAASSQGNFEGDIESVDLAEFAKQQPWWRKLFGPESGLSAEKYSVATHLFIG
Gene ID - Mouse ENSMUSG00000031198
Gene ID - Rat ENSRNOG00000024066
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FUNDC2 pAb (ATL-HPA059129)
Datasheet Anti FUNDC2 pAb (ATL-HPA059129) Datasheet (External Link)
Vendor Page Anti FUNDC2 pAb (ATL-HPA059129) at Atlas Antibodies

Documents & Links for Anti FUNDC2 pAb (ATL-HPA059129)
Datasheet Anti FUNDC2 pAb (ATL-HPA059129) Datasheet (External Link)
Vendor Page Anti FUNDC2 pAb (ATL-HPA059129)