Anti FUCA1 pAb (ATL-HPA056371 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA056371-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: fucosidase, alpha-L- 1, tissue
Gene Name: FUCA1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028673: 94%, ENSRNOG00000009325: 90%
Entrez Gene ID: 2517
Uniprot ID: P04066
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDLVGELGTALRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVSAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTNFLSWL
Gene Sequence RDLVGELGTALRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVSAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTNFLSWL
Gene ID - Mouse ENSMUSG00000028673
Gene ID - Rat ENSRNOG00000009325
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FUCA1 pAb (ATL-HPA056371 w/enhanced validation)
Datasheet Anti FUCA1 pAb (ATL-HPA056371 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FUCA1 pAb (ATL-HPA056371 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FUCA1 pAb (ATL-HPA056371 w/enhanced validation)
Datasheet Anti FUCA1 pAb (ATL-HPA056371 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FUCA1 pAb (ATL-HPA056371 w/enhanced validation)
Citations for Anti FUCA1 pAb (ATL-HPA056371 w/enhanced validation) – 1 Found
Wang, Yutao; Yan, Kexin; Lin, Jiaxing; Li, Jun; Bi, Jianbin. Macrophage M2 Co-expression Factors Correlate With the Immune Microenvironment and Predict Outcome of Renal Clear Cell Carcinoma. Frontiers In Genetics. 12( 33692827):615655.  PubMed