Anti FTO pAb (ATL-HPA068695 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA068695-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: FTO, alpha-ketoglutarate dependent dioxygenase
Gene Name: FTO
Alternative Gene Name: ALKBH9, KIAA1752, MGC5149
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055932: 88%, ENSRNOG00000011728: 89%
Entrez Gene ID: 79068
Uniprot ID: Q9C0B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LFRDLVRIQGKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPVKGSNIKHTEAEIAAACETFLKLNDYLQIETIQALEELAA
Gene Sequence LFRDLVRIQGKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPVKGSNIKHTEAEIAAACETFLKLNDYLQIETIQALEELAA
Gene ID - Mouse ENSMUSG00000055932
Gene ID - Rat ENSRNOG00000011728
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FTO pAb (ATL-HPA068695 w/enhanced validation)
Datasheet Anti FTO pAb (ATL-HPA068695 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FTO pAb (ATL-HPA068695 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FTO pAb (ATL-HPA068695 w/enhanced validation)
Datasheet Anti FTO pAb (ATL-HPA068695 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FTO pAb (ATL-HPA068695 w/enhanced validation)
Citations for Anti FTO pAb (ATL-HPA068695 w/enhanced validation) – 1 Found
Zou, Dongling; Dong, Lei; Li, Chenying; Yin, Zhe; Rao, Shuan; Zhou, Qi. The m(6)A eraser FTO facilitates proliferation and migration of human cervical cancer cells. Cancer Cell International. 19( 31827395):321.  PubMed