Anti FTCD pAb (ATL-HPA030929 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA030929-25
  • Immunohistochemistry analysis in human liver and pancreas tissues using Anti-FTCD antibody. Corresponding FTCD RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
  • Western blot analysis using Anti-FTCD antibody HPA030929 (A) shows similar pattern to independent antibody HPA030928 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: formimidoyltransferase cyclodeaminase
Gene Name: FTCD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001155: 89%, ENSRNOG00000001261: 88%
Entrez Gene ID: 10841
Uniprot ID: O95954
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEH
Gene Sequence MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEH
Gene ID - Mouse ENSMUSG00000001155
Gene ID - Rat ENSRNOG00000001261
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FTCD pAb (ATL-HPA030929 w/enhanced validation)
Datasheet Anti FTCD pAb (ATL-HPA030929 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FTCD pAb (ATL-HPA030929 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FTCD pAb (ATL-HPA030929 w/enhanced validation)
Datasheet Anti FTCD pAb (ATL-HPA030929 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FTCD pAb (ATL-HPA030929 w/enhanced validation)