Anti FSHB pAb (ATL-HPA069703)

Atlas Antibodies

Catalog No.:
ATL-HPA069703-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: follicle stimulating hormone, beta polypeptide
Gene Name: FSHB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027120: 87%, ENSRNOG00000004898: 85%
Entrez Gene ID: 2488
Uniprot ID: P01225
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGK
Gene Sequence TRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGK
Gene ID - Mouse ENSMUSG00000027120
Gene ID - Rat ENSRNOG00000004898
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FSHB pAb (ATL-HPA069703)
Datasheet Anti FSHB pAb (ATL-HPA069703) Datasheet (External Link)
Vendor Page Anti FSHB pAb (ATL-HPA069703) at Atlas Antibodies

Documents & Links for Anti FSHB pAb (ATL-HPA069703)
Datasheet Anti FSHB pAb (ATL-HPA069703) Datasheet (External Link)
Vendor Page Anti FSHB pAb (ATL-HPA069703)