Anti FSCB pAb (ATL-HPA003546)

Atlas Antibodies

Catalog No.:
ATL-HPA003546-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: fibrous sheath CABYR binding protein
Gene Name: FSCB
Alternative Gene Name: C14orf155, DKFZP434F1017
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043060: 36%, ENSRNOG00000032241: 32%
Entrez Gene ID: 84075
Uniprot ID: Q5H9T9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ADLLLTEEFPIGEASAEVSPPPSEQTPEDEALVENVSTEFQSPQVAGIPAVKLGSVVLEGEAKFEEVSKINSVLKDLSNTNDGQAPT
Gene Sequence ADLLLTEEFPIGEASAEVSPPPSEQTPEDEALVENVSTEFQSPQVAGIPAVKLGSVVLEGEAKFEEVSKINSVLKDLSNTNDGQAPT
Gene ID - Mouse ENSMUSG00000043060
Gene ID - Rat ENSRNOG00000032241
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FSCB pAb (ATL-HPA003546)
Datasheet Anti FSCB pAb (ATL-HPA003546) Datasheet (External Link)
Vendor Page Anti FSCB pAb (ATL-HPA003546) at Atlas Antibodies

Documents & Links for Anti FSCB pAb (ATL-HPA003546)
Datasheet Anti FSCB pAb (ATL-HPA003546) Datasheet (External Link)
Vendor Page Anti FSCB pAb (ATL-HPA003546)