Anti FSCB pAb (ATL-HPA003546)

Atlas Antibodies

Catalog No.: ATL-HPA003546-25

Protein Description: fibrous sheath CABYR binding protein
Gene Name: FSCB
Alternative Gene Name: C14orf155, DKFZP434F1017
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043060: 36%, ENSRNOG00000032241: 32%
Entrez Gene ID: 84075
Uniprot ID: Q5H9T9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ADLLLTEEFPIGEASAEVSPPPSEQTPEDEALVENVSTEFQSPQVAGIPAVKLGSVVLEGEAKFEEVSKINSVLKDLSNTNDGQAPT
• Gene Sequence: ADLLLTEEFPIGEASAEVSPPPSEQTPEDEALVENVSTEFQSPQVAGIPAVKLGSVVLEGEAKFEEVSKINSVLKDLSNTNDGQAPT
• Gene ID - Mouse: ENSMUSG00000043060
• Gene ID - Rat: ENSRNOG00000032241
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.