Anti FRY pAb (ATL-HPA041635)

Atlas Antibodies

Catalog No.: ATL-HPA041635-25

Protein Description: furry homolog (Drosophila)
Gene Name: FRY
Alternative Gene Name: 13CDNA73, bA37E23.1, C13orf14, CG003
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056602: 95%, ENSRNOG00000000894: 87%
Entrez Gene ID: 10129
Uniprot ID: Q5TBA9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDVLFGFTNFLLREVNDMHHTLLDSSLKLLLQLLTQWKLVIQTQGKVYEQANKIRNSELIANGSSHRIQSERGPHCSVLHAVE
• Gene Sequence: EDVLFGFTNFLLREVNDMHHTLLDSSLKLLLQLLTQWKLVIQTQGKVYEQANKIRNSELIANGSSHRIQSERGPHCSVLHAVE
• Gene ID - Mouse: ENSMUSG00000056602
• Gene ID - Rat: ENSRNOG00000000894
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.