Anti FRY pAb (ATL-HPA041635)

Atlas Antibodies

Catalog No.:
ATL-HPA041635-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: furry homolog (Drosophila)
Gene Name: FRY
Alternative Gene Name: 13CDNA73, bA37E23.1, C13orf14, CG003
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056602: 95%, ENSRNOG00000000894: 87%
Entrez Gene ID: 10129
Uniprot ID: Q5TBA9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDVLFGFTNFLLREVNDMHHTLLDSSLKLLLQLLTQWKLVIQTQGKVYEQANKIRNSELIANGSSHRIQSERGPHCSVLHAVE
Gene Sequence EDVLFGFTNFLLREVNDMHHTLLDSSLKLLLQLLTQWKLVIQTQGKVYEQANKIRNSELIANGSSHRIQSERGPHCSVLHAVE
Gene ID - Mouse ENSMUSG00000056602
Gene ID - Rat ENSRNOG00000000894
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FRY pAb (ATL-HPA041635)
Datasheet Anti FRY pAb (ATL-HPA041635) Datasheet (External Link)
Vendor Page Anti FRY pAb (ATL-HPA041635) at Atlas Antibodies

Documents & Links for Anti FRY pAb (ATL-HPA041635)
Datasheet Anti FRY pAb (ATL-HPA041635) Datasheet (External Link)
Vendor Page Anti FRY pAb (ATL-HPA041635)