Anti FRMD4B pAb (ATL-HPA009705)

Atlas Antibodies

Catalog No.:
ATL-HPA009705-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: FERM domain containing 4B
Gene Name: FRMD4B
Alternative Gene Name: GRSP1, KIAA1013
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030064: 87%, ENSRNOG00000007764: 88%
Entrez Gene ID: 23150
Uniprot ID: Q9Y2L6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRGWYQRASGQKDQGHSPQTSFDSDRGSQRCLGFAGLQVPCSPSSRASLYSSVSSTNASGNWRTQLTIGLSDYETPAHSSYTSCYGNVYNPLPSPSRQYTEISQLDGTDGN
Gene Sequence LRGWYQRASGQKDQGHSPQTSFDSDRGSQRCLGFAGLQVPCSPSSRASLYSSVSSTNASGNWRTQLTIGLSDYETPAHSSYTSCYGNVYNPLPSPSRQYTEISQLDGTDGN
Gene ID - Mouse ENSMUSG00000030064
Gene ID - Rat ENSRNOG00000007764
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FRMD4B pAb (ATL-HPA009705)
Datasheet Anti FRMD4B pAb (ATL-HPA009705) Datasheet (External Link)
Vendor Page Anti FRMD4B pAb (ATL-HPA009705) at Atlas Antibodies

Documents & Links for Anti FRMD4B pAb (ATL-HPA009705)
Datasheet Anti FRMD4B pAb (ATL-HPA009705) Datasheet (External Link)
Vendor Page Anti FRMD4B pAb (ATL-HPA009705)