Anti FRMD1 pAb (ATL-HPA030347)

Atlas Antibodies

Catalog No.:
ATL-HPA030347-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: FERM domain containing 1
Gene Name: FRMD1
Alternative Gene Name: bA164L23.1, DKFZp434O0117, FLJ00181, FLJ22615, FLJ40260
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048285: 48%, ENSRNOG00000007329: 49%
Entrez Gene ID: 79981
Uniprot ID: Q8N878
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RYFEPHSYFPQWIITKRGIDYILRHMPTLHRERQGLSPKEAMLCFIQEACRLEDVPVHFFRLHKDKKEGRPTVILGLALRGVHIYQGKKLEI
Gene Sequence RYFEPHSYFPQWIITKRGIDYILRHMPTLHRERQGLSPKEAMLCFIQEACRLEDVPVHFFRLHKDKKEGRPTVILGLALRGVHIYQGKKLEI
Gene ID - Mouse ENSMUSG00000048285
Gene ID - Rat ENSRNOG00000007329
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FRMD1 pAb (ATL-HPA030347)
Datasheet Anti FRMD1 pAb (ATL-HPA030347) Datasheet (External Link)
Vendor Page Anti FRMD1 pAb (ATL-HPA030347) at Atlas Antibodies

Documents & Links for Anti FRMD1 pAb (ATL-HPA030347)
Datasheet Anti FRMD1 pAb (ATL-HPA030347) Datasheet (External Link)
Vendor Page Anti FRMD1 pAb (ATL-HPA030347)