Anti FRK pAb (ATL-HPA072590)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072590-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FRK
Alternative Gene Name: GTK, PTK5, RAK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019779: 85%, ENSRNOG00000000543: 87%
Entrez Gene ID: 2444
Uniprot ID: P42685
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RIKRLDEGGFFLTRRRIFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQ |
Gene Sequence | RIKRLDEGGFFLTRRRIFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQ |
Gene ID - Mouse | ENSMUSG00000019779 |
Gene ID - Rat | ENSRNOG00000000543 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FRK pAb (ATL-HPA072590) | |
Datasheet | Anti FRK pAb (ATL-HPA072590) Datasheet (External Link) |
Vendor Page | Anti FRK pAb (ATL-HPA072590) at Atlas Antibodies |
Documents & Links for Anti FRK pAb (ATL-HPA072590) | |
Datasheet | Anti FRK pAb (ATL-HPA072590) Datasheet (External Link) |
Vendor Page | Anti FRK pAb (ATL-HPA072590) |