Anti FRG1 pAb (ATL-HPA075683)

Atlas Antibodies

Catalog No.:
ATL-HPA075683-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: FSHD region gene 1
Gene Name: FRG1
Alternative Gene Name: FRG1A, FSG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031590: 92%, ENSRNOG00000009846: 90%
Entrez Gene ID: 2483
Uniprot ID: Q14331
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen REEHEETQLDIVGIWWTVTNFGEISGTIAIEMDKGTYIH
Gene Sequence REEHEETQLDIVGIWWTVTNFGEISGTIAIEMDKGTYIH
Gene ID - Mouse ENSMUSG00000031590
Gene ID - Rat ENSRNOG00000009846
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FRG1 pAb (ATL-HPA075683)
Datasheet Anti FRG1 pAb (ATL-HPA075683) Datasheet (External Link)
Vendor Page Anti FRG1 pAb (ATL-HPA075683) at Atlas Antibodies

Documents & Links for Anti FRG1 pAb (ATL-HPA075683)
Datasheet Anti FRG1 pAb (ATL-HPA075683) Datasheet (External Link)
Vendor Page Anti FRG1 pAb (ATL-HPA075683)