Anti FRG1 pAb (ATL-HPA075683)

Atlas Antibodies

Catalog No.: ATL-HPA075683-25

Protein Description: FSHD region gene 1
Gene Name: FRG1
Alternative Gene Name: FRG1A, FSG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031590: 92%, ENSRNOG00000009846: 90%
Entrez Gene ID: 2483
Uniprot ID: Q14331
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: REEHEETQLDIVGIWWTVTNFGEISGTIAIEMDKGTYIH
• Gene Sequence: REEHEETQLDIVGIWWTVTNFGEISGTIAIEMDKGTYIH
• Gene ID - Mouse: ENSMUSG00000031590
• Gene ID - Rat: ENSRNOG00000009846
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.