Anti FRG1 pAb (ATL-HPA075683)
Atlas Antibodies
- Catalog No.:
- ATL-HPA075683-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: FRG1
Alternative Gene Name: FRG1A, FSG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031590: 92%, ENSRNOG00000009846: 90%
Entrez Gene ID: 2483
Uniprot ID: Q14331
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | REEHEETQLDIVGIWWTVTNFGEISGTIAIEMDKGTYIH |
| Gene Sequence | REEHEETQLDIVGIWWTVTNFGEISGTIAIEMDKGTYIH |
| Gene ID - Mouse | ENSMUSG00000031590 |
| Gene ID - Rat | ENSRNOG00000009846 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FRG1 pAb (ATL-HPA075683) | |
| Datasheet | Anti FRG1 pAb (ATL-HPA075683) Datasheet (External Link) |
| Vendor Page | Anti FRG1 pAb (ATL-HPA075683) at Atlas Antibodies |
| Documents & Links for Anti FRG1 pAb (ATL-HPA075683) | |
| Datasheet | Anti FRG1 pAb (ATL-HPA075683) Datasheet (External Link) |
| Vendor Page | Anti FRG1 pAb (ATL-HPA075683) |