Anti FREM3 pAb (ATL-HPA041641)

Atlas Antibodies

Catalog No.:
ATL-HPA041641-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: FRAS1 related extracellular matrix 3
Gene Name: FREM3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042353: 62%, ENSRNOG00000039152: 60%
Entrez Gene ID: 166752
Uniprot ID: P0C091
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QHDAFSLILSKDSYQWVVGNSIIEKVQVQVTVLPVDNVGPKVLVGESFIVYEGEKNSLTLQHLHVEDVDTHQDELLCTVTSQPA
Gene Sequence QHDAFSLILSKDSYQWVVGNSIIEKVQVQVTVLPVDNVGPKVLVGESFIVYEGEKNSLTLQHLHVEDVDTHQDELLCTVTSQPA
Gene ID - Mouse ENSMUSG00000042353
Gene ID - Rat ENSRNOG00000039152
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FREM3 pAb (ATL-HPA041641)
Datasheet Anti FREM3 pAb (ATL-HPA041641) Datasheet (External Link)
Vendor Page Anti FREM3 pAb (ATL-HPA041641) at Atlas Antibodies

Documents & Links for Anti FREM3 pAb (ATL-HPA041641)
Datasheet Anti FREM3 pAb (ATL-HPA041641) Datasheet (External Link)
Vendor Page Anti FREM3 pAb (ATL-HPA041641)