Anti FPR2 pAb (ATL-HPA029154)

Atlas Antibodies

Catalog No.:
ATL-HPA029154-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: formyl peptide receptor 2
Gene Name: FPR2
Alternative Gene Name: ALXR, FMLP-R-II, FMLPX, FPR2A, FPRH2, FPRL1, HM63, LXA4R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052270: 63%, ENSRNOG00000042605: 63%
Entrez Gene ID: 2358
Uniprot ID: P25090
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DTYCTFNFASWGGTPEERLKVAITMLTARG
Gene Sequence DTYCTFNFASWGGTPEERLKVAITMLTARG
Gene ID - Mouse ENSMUSG00000052270
Gene ID - Rat ENSRNOG00000042605
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FPR2 pAb (ATL-HPA029154)
Datasheet Anti FPR2 pAb (ATL-HPA029154) Datasheet (External Link)
Vendor Page Anti FPR2 pAb (ATL-HPA029154) at Atlas Antibodies

Documents & Links for Anti FPR2 pAb (ATL-HPA029154)
Datasheet Anti FPR2 pAb (ATL-HPA029154) Datasheet (External Link)
Vendor Page Anti FPR2 pAb (ATL-HPA029154)