Anti FPR2 pAb (ATL-HPA029154)

Atlas Antibodies

Catalog No.: ATL-HPA029154-25

Protein Description: formyl peptide receptor 2
Gene Name: FPR2
Alternative Gene Name: ALXR, FMLP-R-II, FMLPX, FPR2A, FPRH2, FPRL1, HM63, LXA4R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052270: 63%, ENSRNOG00000042605: 63%
Entrez Gene ID: 2358
Uniprot ID: P25090
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTYCTFNFASWGGTPEERLKVAITMLTARG
• Gene Sequence: DTYCTFNFASWGGTPEERLKVAITMLTARG
• Gene ID - Mouse: ENSMUSG00000052270
• Gene ID - Rat: ENSRNOG00000042605
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.