Anti FPR1 pAb (ATL-HPA046550)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046550-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FPR1
Alternative Gene Name: FMLP, FPR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045551: 61%, ENSRNOG00000011174: 49%
Entrez Gene ID: 2357
Uniprot ID: P21462
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLT |
| Gene Sequence | TTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLT |
| Gene ID - Mouse | ENSMUSG00000045551 |
| Gene ID - Rat | ENSRNOG00000011174 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FPR1 pAb (ATL-HPA046550) | |
| Datasheet | Anti FPR1 pAb (ATL-HPA046550) Datasheet (External Link) |
| Vendor Page | Anti FPR1 pAb (ATL-HPA046550) at Atlas Antibodies |
| Documents & Links for Anti FPR1 pAb (ATL-HPA046550) | |
| Datasheet | Anti FPR1 pAb (ATL-HPA046550) Datasheet (External Link) |
| Vendor Page | Anti FPR1 pAb (ATL-HPA046550) |