Anti FOXR2 pAb (ATL-HPA034487)
Atlas Antibodies
- SKU:
- ATL-HPA034487-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FOXR2
Alternative Gene Name: FOXN6, MGC21658
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071665: 36%, ENSRNOG00000030619: 34%
Entrez Gene ID: 139628
Uniprot ID: Q6PJQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VDPNILCPLGSQEAPKPSGKEDLTNISPFPQPPQKDEGSNCSEDKVVESLPSSSSEQSPLQKQGIHS |
| Gene Sequence | VDPNILCPLGSQEAPKPSGKEDLTNISPFPQPPQKDEGSNCSEDKVVESLPSSSSEQSPLQKQGIHS |
| Gene ID - Mouse | ENSMUSG00000071665 |
| Gene ID - Rat | ENSRNOG00000030619 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FOXR2 pAb (ATL-HPA034487) | |
| Datasheet | Anti FOXR2 pAb (ATL-HPA034487) Datasheet (External Link) |
| Vendor Page | Anti FOXR2 pAb (ATL-HPA034487) at Atlas Antibodies |
| Documents & Links for Anti FOXR2 pAb (ATL-HPA034487) | |
| Datasheet | Anti FOXR2 pAb (ATL-HPA034487) Datasheet (External Link) |
| Vendor Page | Anti FOXR2 pAb (ATL-HPA034487) |
| Citations for Anti FOXR2 pAb (ATL-HPA034487) – 1 Found |
| Rahrmann, Eric P; Watson, Adrienne L; Keng, Vincent W; Choi, Kwangmin; Moriarity, Branden S; Beckmann, Dominic A; Wolf, Natalie K; Sarver, Aaron; Collins, Margaret H; Moertel, Christopher L; Wallace, Margaret R; Gel, Bernat; Serra, Eduard; Ratner, Nancy; Largaespada, David A. Forward genetic screen for malignant peripheral nerve sheath tumor formation identifies new genes and pathways driving tumorigenesis. Nature Genetics. 2013;45(7):756-66. PubMed |