Anti FOXQ1 pAb (ATL-HPA059700)

Atlas Antibodies

Catalog No.:
ATL-HPA059700-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: forkhead box Q1
Gene Name: FOXQ1
Alternative Gene Name: HFH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038415: 100%, ENSRNOG00000006293: 59%
Entrez Gene ID: 94234
Uniprot ID: Q9C009
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSH
Gene Sequence DCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSH
Gene ID - Mouse ENSMUSG00000038415
Gene ID - Rat ENSRNOG00000006293
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FOXQ1 pAb (ATL-HPA059700)
Datasheet Anti FOXQ1 pAb (ATL-HPA059700) Datasheet (External Link)
Vendor Page Anti FOXQ1 pAb (ATL-HPA059700) at Atlas Antibodies

Documents & Links for Anti FOXQ1 pAb (ATL-HPA059700)
Datasheet Anti FOXQ1 pAb (ATL-HPA059700) Datasheet (External Link)
Vendor Page Anti FOXQ1 pAb (ATL-HPA059700)