Anti FOXQ1 pAb (ATL-HPA059700)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059700-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FOXQ1
Alternative Gene Name: HFH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038415: 100%, ENSRNOG00000006293: 59%
Entrez Gene ID: 94234
Uniprot ID: Q9C009
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSH |
| Gene Sequence | DCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSH |
| Gene ID - Mouse | ENSMUSG00000038415 |
| Gene ID - Rat | ENSRNOG00000006293 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FOXQ1 pAb (ATL-HPA059700) | |
| Datasheet | Anti FOXQ1 pAb (ATL-HPA059700) Datasheet (External Link) |
| Vendor Page | Anti FOXQ1 pAb (ATL-HPA059700) at Atlas Antibodies |
| Documents & Links for Anti FOXQ1 pAb (ATL-HPA059700) | |
| Datasheet | Anti FOXQ1 pAb (ATL-HPA059700) Datasheet (External Link) |
| Vendor Page | Anti FOXQ1 pAb (ATL-HPA059700) |