Anti FOXP2 pAb (ATL-HPA000382)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000382-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FOXP2
Alternative Gene Name: CAGH44, SPCH1, TNRC10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029563: 99%, ENSRNOG00000054508: 97%
Entrez Gene ID: 93986
Uniprot ID: O15409
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTTSSNTSKASPPITHHS |
Gene Sequence | AQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTTSSNTSKASPPITHHS |
Gene ID - Mouse | ENSMUSG00000029563 |
Gene ID - Rat | ENSRNOG00000054508 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FOXP2 pAb (ATL-HPA000382) | |
Datasheet | Anti FOXP2 pAb (ATL-HPA000382) Datasheet (External Link) |
Vendor Page | Anti FOXP2 pAb (ATL-HPA000382) at Atlas Antibodies |
Documents & Links for Anti FOXP2 pAb (ATL-HPA000382) | |
Datasheet | Anti FOXP2 pAb (ATL-HPA000382) Datasheet (External Link) |
Vendor Page | Anti FOXP2 pAb (ATL-HPA000382) |
Citations for Anti FOXP2 pAb (ATL-HPA000382) – 16 Found |
Zuko, Amila; Oguro-Ando, Asami; van Dijk, Roland; Gregorio-Jordan, Sara; van der Zwaag, Bert; Burbach, J Peter H. Developmental role of the cell adhesion molecule Contactin-6 in the cerebral cortex and hippocampus. Cell Adhesion & Migration. 2016;10(4):378-92. PubMed |
Toda, Tomohisa; Shinmyo, Yohei; Dinh Duong, Tung Anh; Masuda, Kosuke; Kawasaki, Hiroshi. An essential role of SVZ progenitors in cortical folding in gyrencephalic mammals. Scientific Reports. 2016;6( 27403992):29578. PubMed |
Wallace, Michael L; Saunders, Arpiar; Huang, Kee Wui; Philson, Adrienne C; Goldman, Melissa; Macosko, Evan Z; McCarroll, Steven A; Sabatini, Bernardo L. Genetically Distinct Parallel Pathways in the Entopeduncular Nucleus for Limbic and Sensorimotor Output of the Basal Ganglia. Neuron. 2017;94(1):138-152.e5. PubMed |
Matsumoto, Naoyuki; Shinmyo, Yohei; Ichikawa, Yoshie; Kawasaki, Hiroshi. Gyrification of the cerebral cortex requires FGF signaling in the mammalian brain. Elife. 2017;6( 29132503) PubMed |
Shi, Zhimin; Piccus, Zoe; Zhang, Xiaofang; Yang, Huidi; Jarrell, Hannah; Ding, Yan; Teng, Zhaoqian; Tchernichovski, Ofer; Li, XiaoChing. miR-9 regulates basal ganglia-dependent developmental vocal learning and adult vocal performance in songbirds. Elife. 2018;7( 29345619) PubMed |
Klug, Jason R; Engelhardt, Max D; Cadman, Cara N; Li, Hao; Smith, Jared B; Ayala, Sarah; Williams, Elora W; Hoffman, Hilary; Jin, Xin. Differential inputs to striatal cholinergic and parvalbumin interneurons imply functional distinctions. Elife. 2018;7( 29714166) PubMed |
Cui, Qiaoling; Pamukcu, Arin; Cherian, Suraj; Chang, Isaac Y M; Berceau, Brianna L; Xenias, Harry S; Higgs, Matthew H; Rajamanickam, Shivakumar; Chen, Yi; Du, Xixun; Zhang, Yu; McMorrow, Hayley; Abecassis, Zachary A; Boca, Simina M; Justice, Nicholas J; Wilson, Charles J; Chan, C Savio. Dissociable Roles of Pallidal Neuron Subtypes in Regulating Motor Patterns. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2021;41(18):4036-4059. PubMed |
Li, Jun; Sun, Xiaoxuan; You, Yang; Li, Qiongwei; Wei, Chengwen; Zhao, Linnan; Sun, Mengwen; Meng, Hu; Zhang, Tian; Yue, Weihua; Wang, Lifang; Zhang, Dai. Auts2 deletion involves in DG hypoplasia and social recognition deficit: The developmental and neural circuit mechanisms. Science Advances. 2022;8(9):eabk1238. PubMed |
Enard, Wolfgang; Gehre, Sabine; Hammerschmidt, Kurt; Hölter, Sabine M; Blass, Torsten; Somel, Mehmet; Brückner, Martina K; Schreiweis, Christiane; Winter, Christine; Sohr, Reinhard; Becker, Lore; Wiebe, Victor; Nickel, Birgit; Giger, Thomas; Müller, Uwe; Groszer, Matthias; Adler, Thure; Aguilar, Antonio; Bolle, Ines; Calzada-Wack, Julia; Dalke, Claudia; Ehrhardt, Nicole; Favor, Jack; Fuchs, Helmut; Gailus-Durner, Valérie; Hans, Wolfgang; Hölzlwimmer, Gabriele; Javaheri, Anahita; Kalaydjiev, Svetoslav; Kallnik, Magdalena; Kling, Eva; Kunder, Sandra; Mossbrugger, Ilona; Naton, Beatrix; Racz, Ildikó; Rathkolb, Birgit; Rozman, Jan; Schrewe, Anja; Busch, Dirk H; Graw, Jochen; Ivandic, Boris; Klingenspor, Martin; Klopstock, Thomas; Ollert, Markus; Quintanilla-Martinez, Leticia; Schulz, Holger; Wolf, Eckhard; Wurst, Wolfgang; Zimmer, Andreas; Fisher, Simon E; Morgenstern, Rudolf; Arendt, Thomas; de Angelis, Martin Hrabé; Fischer, Julia; Schwarz, Johannes; Pääbo, Svante. A humanized version of Foxp2 affects cortico-basal ganglia circuits in mice. Cell. 2009;137(5):961-71. PubMed |
Reimers-Kipping, S; Hevers, W; Pääbo, S; Enard, W. Humanized Foxp2 specifically affects cortico-basal ganglia circuits. Neuroscience. 2011;175( 21111790):75-84. PubMed |
Abdi, Azzedine; Mallet, Nicolas; Mohamed, Foad Y; Sharott, Andrew; Dodson, Paul D; Nakamura, Kouichi C; Suri, Sana; Avery, Sophie V; Larvin, Joseph T; Garas, Farid N; Garas, Shady N; Vinciati, Federica; Morin, Stéphanie; Bezard, Erwan; Baufreton, Jérôme; Magill, Peter J. Prototypic and arkypallidal neurons in the dopamine-intact external globus pallidus. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2015;35(17):6667-88. PubMed |
Hernández, Vivian M; Hegeman, Daniel J; Cui, Qiaoling; Kelver, Daniel A; Fiske, Michael P; Glajch, Kelly E; Pitt, Jason E; Huang, Tina Y; Justice, Nicholas J; Chan, C Savio. Parvalbumin+ Neurons and Npas1+ Neurons Are Distinct Neuron Classes in the Mouse External Globus Pallidus. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2015;35(34):11830-47. PubMed |
Brunjes, Peter C; Osterberg, Stephen K. Developmental Markers Expressed in Neocortical Layers Are Differentially Exhibited in Olfactory Cortex. Plos One. 10(9):e0138541. PubMed |
Abecassis, Zachary A; Berceau, Brianna L; Win, Phyo H; García, Daniela; Xenias, Harry S; Cui, Qiaoling; Pamukcu, Arin; Cherian, Suraj; Hernández, Vivian M; Chon, Uree; Lim, Byung Kook; Kim, Yongsoo; Justice, Nicholas J; Awatramani, Raj; Hooks, Bryan M; Gerfen, Charles R; Boca, Simina M; Chan, C Savio. Npas1(+)-Nkx2.1(+) Neurons Are an Integral Part of the Cortico-pallido-cortical Loop. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2020;40(4):743-768. PubMed |
Kobayashi, Hiroaki; Takemoto, Kenji; Sanbo, Makoto; Hirabayashi, Masumi; Hirabayashi, Takahiro; Hirayama, Teruyoshi; Kiyonari, Hiroshi; Abe, Takaya; Yagi, Takeshi. Isoform requirement of clustered protocadherin for preventing neuronal apoptosis and neonatal lethality. Iscience. 2023;26(1):105766. PubMed |
Chen, Fan; Byrd, Aria L; Liu, Jinpeng; Flight, Robert M; DuCote, Tanner J; Naughton, Kassandra J; Song, Xiulong; Edgin, Abigail R; Lukyanchuk, Alexsandr; Dixon, Danielle T; Gosser, Christian M; Esoe, Dave-Preston; Jayswal, Rani D; Orkin, Stuart H; Moseley, Hunter N B; Wang, Chi; Brainson, Christine Fillmore. Polycomb deficiency drives a FOXP2-high aggressive state targetable by epigenetic inhibitors. Nature Communications. 2023;14(1):336. PubMed |