Anti FOXO3 pAb (ATL-HPA063104)

Atlas Antibodies

Catalog No.: ATL-HPA063104-25

Protein Description: forkhead box O3
Gene Name: FOXO3
Alternative Gene Name: AF6q21, FKHRL1, FOXO2, FOXO3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048756: 95%, ENSRNOG00000000299: 95%
Entrez Gene ID: 2309
Uniprot ID: O43524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSVVNQNLLHHQHQTQGALGGSRALS
• Gene Sequence: QASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSVVNQNLLHHQHQTQGALGGSRALS
• Gene ID - Mouse: ENSMUSG00000048756
• Gene ID - Rat: ENSRNOG00000000299
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.