Anti FOXO3 pAb (ATL-HPA063104)

Atlas Antibodies

Catalog No.:
ATL-HPA063104-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: forkhead box O3
Gene Name: FOXO3
Alternative Gene Name: AF6q21, FKHRL1, FOXO2, FOXO3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048756: 95%, ENSRNOG00000000299: 95%
Entrez Gene ID: 2309
Uniprot ID: O43524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSVVNQNLLHHQHQTQGALGGSRALS
Gene Sequence QASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSVVNQNLLHHQHQTQGALGGSRALS
Gene ID - Mouse ENSMUSG00000048756
Gene ID - Rat ENSRNOG00000000299
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FOXO3 pAb (ATL-HPA063104)
Datasheet Anti FOXO3 pAb (ATL-HPA063104) Datasheet (External Link)
Vendor Page Anti FOXO3 pAb (ATL-HPA063104) at Atlas Antibodies

Documents & Links for Anti FOXO3 pAb (ATL-HPA063104)
Datasheet Anti FOXO3 pAb (ATL-HPA063104) Datasheet (External Link)
Vendor Page Anti FOXO3 pAb (ATL-HPA063104)