Anti FOXO1 pAb (ATL-HPA001252 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001252-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: FOXO1
Alternative Gene Name: FKH1, FKHR, FOXO1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044167: 91%, ENSRNOG00000013397: 90%
Entrez Gene ID: 2308
Uniprot ID: Q12778
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDM |
| Gene Sequence | LTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDM |
| Gene ID - Mouse | ENSMUSG00000044167 |
| Gene ID - Rat | ENSRNOG00000013397 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FOXO1 pAb (ATL-HPA001252 w/enhanced validation) | |
| Datasheet | Anti FOXO1 pAb (ATL-HPA001252 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FOXO1 pAb (ATL-HPA001252 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FOXO1 pAb (ATL-HPA001252 w/enhanced validation) | |
| Datasheet | Anti FOXO1 pAb (ATL-HPA001252 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FOXO1 pAb (ATL-HPA001252 w/enhanced validation) |
| Citations for Anti FOXO1 pAb (ATL-HPA001252 w/enhanced validation) – 3 Found |
| Sahu, Biswajyoti; Laakso, Marko; Ovaska, Kristian; Mirtti, Tuomas; Lundin, Johan; Rannikko, Antti; Sankila, Anna; Turunen, Juha-Pekka; Lundin, Mikael; Konsti, Juho; Vesterinen, Tiina; Nordling, Stig; Kallioniemi, Olli; Hautaniemi, Sampsa; Jänne, Olli A. Dual role of FoxA1 in androgen receptor binding to chromatin, androgen signalling and prostate cancer. The Embo Journal. 2011;30(19):3962-76. PubMed |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |
| Tao, Anqi; Wang, Xing; Li, Cuiying. Effect of Lycopene on Oral Squamous Cell Carcinoma Cell Growth by Inhibiting IGF1 Pathway. Cancer Management And Research. 13( 33531840):723-732. PubMed |