Anti FOXN3 pAb (ATL-HPA059209)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059209-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FOXN3
Alternative Gene Name: C14orf116, CHES1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033713: 92%, ENSRNOG00000004709: 92%
Entrez Gene ID: 1112
Uniprot ID: O00409
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC, ChIP |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MGPVMPPSKKPESSGISVSSGLSQCYGGSGFSKALQEDDDLDFSLPDIRLEEGAMEDEELT |
| Gene Sequence | MGPVMPPSKKPESSGISVSSGLSQCYGGSGFSKALQEDDDLDFSLPDIRLEEGAMEDEELT |
| Gene ID - Mouse | ENSMUSG00000033713 |
| Gene ID - Rat | ENSRNOG00000004709 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FOXN3 pAb (ATL-HPA059209) | |
| Datasheet | Anti FOXN3 pAb (ATL-HPA059209) Datasheet (External Link) |
| Vendor Page | Anti FOXN3 pAb (ATL-HPA059209) at Atlas Antibodies |
| Documents & Links for Anti FOXN3 pAb (ATL-HPA059209) | |
| Datasheet | Anti FOXN3 pAb (ATL-HPA059209) Datasheet (External Link) |
| Vendor Page | Anti FOXN3 pAb (ATL-HPA059209) |
| Citations for Anti FOXN3 pAb (ATL-HPA059209) – 2 Found |
| He, Hang; Zhang, Jinjing; Qu, Yi; Wang, Yue; Zhang, Yan; Yan, Xiaojing; Li, Yan; Zhang, Rui. Novel tumor-suppressor FOXN3 is downregulated in adult acute myeloid leukemia. Oncology Letters. 2019;18(2):1521-1529. PubMed |
| Zhang, Jinjing; Wang, Yue; Mo, Wenbin; Zhang, Rui; Li, Yan. The clinical and prognostic significance of FOXN3 downregulation in acute myeloid leukaemia. International Journal Of Laboratory Hematology. 2020;42(3):270-276. PubMed |