Anti FOXN2 pAb (ATL-HPA003485)

Atlas Antibodies

Catalog No.:
ATL-HPA003485-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: forkhead box N2
Gene Name: FOXN2
Alternative Gene Name: HTLF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034998: 80%, ENSRNOG00000040110: 84%
Entrez Gene ID: 3344
Uniprot ID: P32314
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLIQALKKQPFSSASSQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHHPSAVRLQESDSLATSIDPKEDHNYSA
Gene Sequence LSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLIQALKKQPFSSASSQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHHPSAVRLQESDSLATSIDPKEDHNYSA
Gene ID - Mouse ENSMUSG00000034998
Gene ID - Rat ENSRNOG00000040110
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FOXN2 pAb (ATL-HPA003485)
Datasheet Anti FOXN2 pAb (ATL-HPA003485) Datasheet (External Link)
Vendor Page Anti FOXN2 pAb (ATL-HPA003485) at Atlas Antibodies

Documents & Links for Anti FOXN2 pAb (ATL-HPA003485)
Datasheet Anti FOXN2 pAb (ATL-HPA003485) Datasheet (External Link)
Vendor Page Anti FOXN2 pAb (ATL-HPA003485)
Citations for Anti FOXN2 pAb (ATL-HPA003485) – 1 Found
Ye, Hui; Duan, Meiling. FOXN2 is downregulated in breast cancer and regulates migration, invasion, and epithelial- mesenchymal transition through regulation of SLUG. Cancer Management And Research. 11( 30655703):525-535.  PubMed