Anti FOXN2 pAb (ATL-HPA003485)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003485-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FOXN2
Alternative Gene Name: HTLF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034998: 80%, ENSRNOG00000040110: 84%
Entrez Gene ID: 3344
Uniprot ID: P32314
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLIQALKKQPFSSASSQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHHPSAVRLQESDSLATSIDPKEDHNYSA |
| Gene Sequence | LSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLIQALKKQPFSSASSQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHHPSAVRLQESDSLATSIDPKEDHNYSA |
| Gene ID - Mouse | ENSMUSG00000034998 |
| Gene ID - Rat | ENSRNOG00000040110 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FOXN2 pAb (ATL-HPA003485) | |
| Datasheet | Anti FOXN2 pAb (ATL-HPA003485) Datasheet (External Link) |
| Vendor Page | Anti FOXN2 pAb (ATL-HPA003485) at Atlas Antibodies |
| Documents & Links for Anti FOXN2 pAb (ATL-HPA003485) | |
| Datasheet | Anti FOXN2 pAb (ATL-HPA003485) Datasheet (External Link) |
| Vendor Page | Anti FOXN2 pAb (ATL-HPA003485) |
| Citations for Anti FOXN2 pAb (ATL-HPA003485) – 1 Found |
| Ye, Hui; Duan, Meiling. FOXN2 is downregulated in breast cancer and regulates migration, invasion, and epithelial- mesenchymal transition through regulation of SLUG. Cancer Management And Research. 11( 30655703):525-535. PubMed |