Anti FOXN2 pAb (ATL-HPA003485)

Atlas Antibodies

SKU: ATL-HPA003485-25

• 
• 

Protein Description: forkhead box N2
Gene Name: FOXN2
Alternative Gene Name: HTLF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034998: 80%, ENSRNOG00000040110: 84%
Entrez Gene ID: 3344
Uniprot ID: P32314
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLIQALKKQPFSSASSQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHHPSAVRLQESDSLATSIDPKEDHNYSA
• Gene Sequence: LSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLIQALKKQPFSSASSQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHHPSAVRLQESDSLATSIDPKEDHNYSA
• Gene ID - Mouse: ENSMUSG00000034998
• Gene ID - Rat: ENSRNOG00000040110
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FOXN2 pAb (ATL-HPA003485) – 1 Found

Ye, Hui; Duan, Meiling. FOXN2 is downregulated in breast cancer and regulates migration, invasion, and epithelial- mesenchymal transition through regulation of SLUG. Cancer Management And Research. 11( 30655703):525-535.