Anti FOXL2NB pAb (ATL-HPA061017)

Atlas Antibodies

Catalog No.:
ATL-HPA061017-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: FOXL2 neighbor
Gene Name: FOXL2NB
Alternative Gene Name: C3orf72, FLJ43329
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019578: 30%, ENSRNOG00000030098: 29%
Entrez Gene ID: 401089
Uniprot ID: Q6ZUU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PALVKKRMPDACTLGRAGIGLPKMCLHMAVRHSKAQKTGPGILQQRQKPPAPRASGGPALLGKRRGCSEA
Gene Sequence PALVKKRMPDACTLGRAGIGLPKMCLHMAVRHSKAQKTGPGILQQRQKPPAPRASGGPALLGKRRGCSEA
Gene ID - Mouse ENSMUSG00000019578
Gene ID - Rat ENSRNOG00000030098
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FOXL2NB pAb (ATL-HPA061017)
Datasheet Anti FOXL2NB pAb (ATL-HPA061017) Datasheet (External Link)
Vendor Page Anti FOXL2NB pAb (ATL-HPA061017) at Atlas Antibodies

Documents & Links for Anti FOXL2NB pAb (ATL-HPA061017)
Datasheet Anti FOXL2NB pAb (ATL-HPA061017) Datasheet (External Link)
Vendor Page Anti FOXL2NB pAb (ATL-HPA061017)