Anti FOXL2NB pAb (ATL-HPA061017)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061017-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: FOXL2NB
Alternative Gene Name: C3orf72, FLJ43329
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019578: 30%, ENSRNOG00000030098: 29%
Entrez Gene ID: 401089
Uniprot ID: Q6ZUU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PALVKKRMPDACTLGRAGIGLPKMCLHMAVRHSKAQKTGPGILQQRQKPPAPRASGGPALLGKRRGCSEA |
| Gene Sequence | PALVKKRMPDACTLGRAGIGLPKMCLHMAVRHSKAQKTGPGILQQRQKPPAPRASGGPALLGKRRGCSEA |
| Gene ID - Mouse | ENSMUSG00000019578 |
| Gene ID - Rat | ENSRNOG00000030098 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FOXL2NB pAb (ATL-HPA061017) | |
| Datasheet | Anti FOXL2NB pAb (ATL-HPA061017) Datasheet (External Link) |
| Vendor Page | Anti FOXL2NB pAb (ATL-HPA061017) at Atlas Antibodies |
| Documents & Links for Anti FOXL2NB pAb (ATL-HPA061017) | |
| Datasheet | Anti FOXL2NB pAb (ATL-HPA061017) Datasheet (External Link) |
| Vendor Page | Anti FOXL2NB pAb (ATL-HPA061017) |