Anti FOXK2 pAb (ATL-HPA073491)

Atlas Antibodies

Catalog No.:
ATL-HPA073491-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: forkhead box K2
Gene Name: FOXK2
Alternative Gene Name: ILF, ILF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039275: 86%, ENSRNOG00000036663: 69%
Entrez Gene ID: 3607
Uniprot ID: Q01167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTHVASVPTAVHGQVNNAAASPLHMLATHASASASLPTKRHNGDQPEQPELKRIKTEDGEGIVIALSVDTPPAAVRE
Gene Sequence GTHVASVPTAVHGQVNNAAASPLHMLATHASASASLPTKRHNGDQPEQPELKRIKTEDGEGIVIALSVDTPPAAVRE
Gene ID - Mouse ENSMUSG00000039275
Gene ID - Rat ENSRNOG00000036663
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FOXK2 pAb (ATL-HPA073491)
Datasheet Anti FOXK2 pAb (ATL-HPA073491) Datasheet (External Link)
Vendor Page Anti FOXK2 pAb (ATL-HPA073491) at Atlas Antibodies

Documents & Links for Anti FOXK2 pAb (ATL-HPA073491)
Datasheet Anti FOXK2 pAb (ATL-HPA073491) Datasheet (External Link)
Vendor Page Anti FOXK2 pAb (ATL-HPA073491)