Anti FOXJ3 pAb (ATL-HPA067284)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067284-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FOXJ3
Alternative Gene Name: KIAA1041
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032998: 95%, ENSRNOG00000061851: 98%
Entrez Gene ID: 22887
Uniprot ID: Q9UPW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GMECIISGSASPTLAINTVTNKVTLYNTDQDGSDSPRSSLNNSLSDQSLASVNLNSVGSVHSYTPVTSHPESVSQSLTPQQQ |
Gene Sequence | GMECIISGSASPTLAINTVTNKVTLYNTDQDGSDSPRSSLNNSLSDQSLASVNLNSVGSVHSYTPVTSHPESVSQSLTPQQQ |
Gene ID - Mouse | ENSMUSG00000032998 |
Gene ID - Rat | ENSRNOG00000061851 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FOXJ3 pAb (ATL-HPA067284) | |
Datasheet | Anti FOXJ3 pAb (ATL-HPA067284) Datasheet (External Link) |
Vendor Page | Anti FOXJ3 pAb (ATL-HPA067284) at Atlas Antibodies |
Documents & Links for Anti FOXJ3 pAb (ATL-HPA067284) | |
Datasheet | Anti FOXJ3 pAb (ATL-HPA067284) Datasheet (External Link) |
Vendor Page | Anti FOXJ3 pAb (ATL-HPA067284) |