Anti FOXJ3 pAb (ATL-HPA067284)

Atlas Antibodies

Catalog No.:
ATL-HPA067284-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: forkhead box J3
Gene Name: FOXJ3
Alternative Gene Name: KIAA1041
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032998: 95%, ENSRNOG00000061851: 98%
Entrez Gene ID: 22887
Uniprot ID: Q9UPW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GMECIISGSASPTLAINTVTNKVTLYNTDQDGSDSPRSSLNNSLSDQSLASVNLNSVGSVHSYTPVTSHPESVSQSLTPQQQ
Gene Sequence GMECIISGSASPTLAINTVTNKVTLYNTDQDGSDSPRSSLNNSLSDQSLASVNLNSVGSVHSYTPVTSHPESVSQSLTPQQQ
Gene ID - Mouse ENSMUSG00000032998
Gene ID - Rat ENSRNOG00000061851
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FOXJ3 pAb (ATL-HPA067284)
Datasheet Anti FOXJ3 pAb (ATL-HPA067284) Datasheet (External Link)
Vendor Page Anti FOXJ3 pAb (ATL-HPA067284) at Atlas Antibodies

Documents & Links for Anti FOXJ3 pAb (ATL-HPA067284)
Datasheet Anti FOXJ3 pAb (ATL-HPA067284) Datasheet (External Link)
Vendor Page Anti FOXJ3 pAb (ATL-HPA067284)