Anti FOXF1 pAb (ATL-HPA028886)

Atlas Antibodies

Catalog No.: ATL-HPA028886-100

Protein Description: forkhead box F1
Gene Name: FOXF1
Alternative Gene Name: FKHL5, FREAC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042812: 94%, ENSRNOG00000049906: 94%
Entrez Gene ID: 2294
Uniprot ID: Q12946
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GFRRKCQALKPMYSMMNGLGFNHLPDTYGFQGSAGGLSCPPNSLALEGGLGMMNGHLPGNVDGMALPSHSVPHLPSNGGHSYMGG
• Gene Sequence: GFRRKCQALKPMYSMMNGLGFNHLPDTYGFQGSAGGLSCPPNSLALEGGLGMMNGHLPGNVDGMALPSHSVPHLPSNGGHSYMGG
• Gene ID - Mouse: ENSMUSG00000042812
• Gene ID - Rat: ENSRNOG00000049906
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FOXF1 pAb (ATL-HPA028886) – 1 Found

Lo, Pang-Kuo; Lee, Ji Shin; Sukumar, Saraswati. The p53-p21WAF1 checkpoint pathway plays a protective role in preventing DNA rereplication induced by abrogation of FOXF1 function. Cellular Signalling. 2012;24(1):316-24.