Anti FOXC2 pAb (ATL-HPA056302)

Atlas Antibodies

Catalog No.:
ATL-HPA056302-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: forkhead box C2
Gene Name: FOXC2
Alternative Gene Name: FKHL14, MFH-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046714: 88%, ENSRNOG00000047446: 89%
Entrez Gene ID: 2303
Uniprot ID: Q99958
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTK
Gene Sequence SGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTK
Gene ID - Mouse ENSMUSG00000046714
Gene ID - Rat ENSRNOG00000047446
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FOXC2 pAb (ATL-HPA056302)
Datasheet Anti FOXC2 pAb (ATL-HPA056302) Datasheet (External Link)
Vendor Page Anti FOXC2 pAb (ATL-HPA056302) at Atlas Antibodies

Documents & Links for Anti FOXC2 pAb (ATL-HPA056302)
Datasheet Anti FOXC2 pAb (ATL-HPA056302) Datasheet (External Link)
Vendor Page Anti FOXC2 pAb (ATL-HPA056302)