Anti FOXB2 pAb (ATL-HPA067947)

Atlas Antibodies

Catalog No.:
ATL-HPA067947-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: forkhead box B2
Gene Name: FOXB2
Alternative Gene Name: bA159H20.4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056829: 96%, ENSRNOG00000032137: 96%
Entrez Gene ID: 442425
Uniprot ID: Q5VYV0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IGRDYKGVLQAGGLPLASVMHHLGYPVPGQLGNVVSSVWPHVGVMD
Gene Sequence IGRDYKGVLQAGGLPLASVMHHLGYPVPGQLGNVVSSVWPHVGVMD
Gene ID - Mouse ENSMUSG00000056829
Gene ID - Rat ENSRNOG00000032137
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FOXB2 pAb (ATL-HPA067947)
Datasheet Anti FOXB2 pAb (ATL-HPA067947) Datasheet (External Link)
Vendor Page Anti FOXB2 pAb (ATL-HPA067947) at Atlas Antibodies

Documents & Links for Anti FOXB2 pAb (ATL-HPA067947)
Datasheet Anti FOXB2 pAb (ATL-HPA067947) Datasheet (External Link)
Vendor Page Anti FOXB2 pAb (ATL-HPA067947)