Anti FOXA3 pAb (ATL-HPA054034)

Atlas Antibodies

Catalog No.:
ATL-HPA054034-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: forkhead box A3
Gene Name: FOXA3
Alternative Gene Name: HNF3G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040891: 95%, ENSRNOG00000014256: 94%
Entrez Gene ID: 3171
Uniprot ID: P55318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGP
Gene Sequence LGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGP
Gene ID - Mouse ENSMUSG00000040891
Gene ID - Rat ENSRNOG00000014256
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FOXA3 pAb (ATL-HPA054034)
Datasheet Anti FOXA3 pAb (ATL-HPA054034) Datasheet (External Link)
Vendor Page Anti FOXA3 pAb (ATL-HPA054034) at Atlas Antibodies

Documents & Links for Anti FOXA3 pAb (ATL-HPA054034)
Datasheet Anti FOXA3 pAb (ATL-HPA054034) Datasheet (External Link)
Vendor Page Anti FOXA3 pAb (ATL-HPA054034)