Anti FOXA2 pAb (ATL-HPA066846)

Atlas Antibodies

Catalog No.:
ATL-HPA066846-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: forkhead box A2
Gene Name: FOXA2
Alternative Gene Name: HNF3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037025: 96%, ENSRNOG00000013133: 94%
Entrez Gene ID: 3170
Uniprot ID: Q9Y261
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTS
Gene Sequence SHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTS
Gene ID - Mouse ENSMUSG00000037025
Gene ID - Rat ENSRNOG00000013133
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FOXA2 pAb (ATL-HPA066846)
Datasheet Anti FOXA2 pAb (ATL-HPA066846) Datasheet (External Link)
Vendor Page Anti FOXA2 pAb (ATL-HPA066846) at Atlas Antibodies

Documents & Links for Anti FOXA2 pAb (ATL-HPA066846)
Datasheet Anti FOXA2 pAb (ATL-HPA066846) Datasheet (External Link)
Vendor Page Anti FOXA2 pAb (ATL-HPA066846)