Anti FOXA1 pAb (ATL-HPA050505 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA050505-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: forkhead box A1
Gene Name: FOXA1
Alternative Gene Name: HNF3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035451: 96%, ENSRNOG00000009284: 82%
Entrez Gene ID: 3169
Uniprot ID: P55317
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHP
Gene Sequence QTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHP
Gene ID - Mouse ENSMUSG00000035451
Gene ID - Rat ENSRNOG00000009284
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FOXA1 pAb (ATL-HPA050505 w/enhanced validation)
Datasheet Anti FOXA1 pAb (ATL-HPA050505 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FOXA1 pAb (ATL-HPA050505 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FOXA1 pAb (ATL-HPA050505 w/enhanced validation)
Datasheet Anti FOXA1 pAb (ATL-HPA050505 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FOXA1 pAb (ATL-HPA050505 w/enhanced validation)
Citations for Anti FOXA1 pAb (ATL-HPA050505 w/enhanced validation) – 2 Found
Robboy, Stanley J; Kurita, Takeshi; Baskin, Laurence; Cunha, Gerald R. New insights into human female reproductive tract development. Differentiation; Research In Biological Diversity. 2017;97( 28918284):9-22.  PubMed
Milan, Marta; Balestrieri, Chiara; Alfarano, Gabriele; Polletti, Sara; Prosperini, Elena; Spaggiari, Paola; Zerbi, Alessandro; Diaferia, Giuseppe R; Natoli, Gioacchino. FOXA2 controls the cis-regulatory networks of pancreatic cancer cells in a differentiation grade-specific manner. The Embo Journal. 2019;38(20):e102161.  PubMed