Anti FOXA1 pAb (ATL-HPA050505 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050505-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FOXA1
Alternative Gene Name: HNF3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035451: 96%, ENSRNOG00000009284: 82%
Entrez Gene ID: 3169
Uniprot ID: P55317
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHP |
| Gene Sequence | QTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHP |
| Gene ID - Mouse | ENSMUSG00000035451 |
| Gene ID - Rat | ENSRNOG00000009284 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FOXA1 pAb (ATL-HPA050505 w/enhanced validation) | |
| Datasheet | Anti FOXA1 pAb (ATL-HPA050505 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FOXA1 pAb (ATL-HPA050505 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FOXA1 pAb (ATL-HPA050505 w/enhanced validation) | |
| Datasheet | Anti FOXA1 pAb (ATL-HPA050505 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FOXA1 pAb (ATL-HPA050505 w/enhanced validation) |
| Citations for Anti FOXA1 pAb (ATL-HPA050505 w/enhanced validation) – 2 Found |
| Robboy, Stanley J; Kurita, Takeshi; Baskin, Laurence; Cunha, Gerald R. New insights into human female reproductive tract development. Differentiation; Research In Biological Diversity. 2017;97( 28918284):9-22. PubMed |
| Milan, Marta; Balestrieri, Chiara; Alfarano, Gabriele; Polletti, Sara; Prosperini, Elena; Spaggiari, Paola; Zerbi, Alessandro; Diaferia, Giuseppe R; Natoli, Gioacchino. FOXA2 controls the cis-regulatory networks of pancreatic cancer cells in a differentiation grade-specific manner. The Embo Journal. 2019;38(20):e102161. PubMed |