Anti FOSL2 pAb (ATL-HPA061417)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061417-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: FOSL2
Alternative Gene Name: FLJ23306, FRA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029135: 100%, ENSRNOG00000020552: 41%
Entrez Gene ID: 2355
Uniprot ID: P15408
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLS |
| Gene Sequence | WMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLS |
| Gene ID - Mouse | ENSMUSG00000029135 |
| Gene ID - Rat | ENSRNOG00000020552 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FOSL2 pAb (ATL-HPA061417) | |
| Datasheet | Anti FOSL2 pAb (ATL-HPA061417) Datasheet (External Link) |
| Vendor Page | Anti FOSL2 pAb (ATL-HPA061417) at Atlas Antibodies |
| Documents & Links for Anti FOSL2 pAb (ATL-HPA061417) | |
| Datasheet | Anti FOSL2 pAb (ATL-HPA061417) Datasheet (External Link) |
| Vendor Page | Anti FOSL2 pAb (ATL-HPA061417) |