Anti FOSB pAb (ATL-HPA054663)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054663-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FOSB
Alternative Gene Name: AP-1, DKFZp686C0818, G0S3, GOS3, GOSB, MGC42291
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003545: 94%, ENSRNOG00000046667: 94%
Entrez Gene ID: 2354
Uniprot ID: P53539
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAF |
| Gene Sequence | LPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAF |
| Gene ID - Mouse | ENSMUSG00000003545 |
| Gene ID - Rat | ENSRNOG00000046667 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FOSB pAb (ATL-HPA054663) | |
| Datasheet | Anti FOSB pAb (ATL-HPA054663) Datasheet (External Link) |
| Vendor Page | Anti FOSB pAb (ATL-HPA054663) at Atlas Antibodies |
| Documents & Links for Anti FOSB pAb (ATL-HPA054663) | |
| Datasheet | Anti FOSB pAb (ATL-HPA054663) Datasheet (External Link) |
| Vendor Page | Anti FOSB pAb (ATL-HPA054663) |