Anti FNDC5 pAb (ATL-HPA051290)

Atlas Antibodies

Catalog No.:
ATL-HPA051290-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: fibronectin type III domain containing 5
Gene Name: FNDC5
Alternative Gene Name: FRCP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001334: 100%, ENSRNOG00000030238: 100%
Entrez Gene ID: 252995
Uniprot ID: Q8NAU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLR
Gene Sequence EDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLR
Gene ID - Mouse ENSMUSG00000001334
Gene ID - Rat ENSRNOG00000030238
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FNDC5 pAb (ATL-HPA051290)
Datasheet Anti FNDC5 pAb (ATL-HPA051290) Datasheet (External Link)
Vendor Page Anti FNDC5 pAb (ATL-HPA051290) at Atlas Antibodies

Documents & Links for Anti FNDC5 pAb (ATL-HPA051290)
Datasheet Anti FNDC5 pAb (ATL-HPA051290) Datasheet (External Link)
Vendor Page Anti FNDC5 pAb (ATL-HPA051290)
Citations for Anti FNDC5 pAb (ATL-HPA051290) – 1 Found
Komolka, Katrin; Albrecht, Elke; Schering, Lisa; Brenmoehl, Julia; Hoeflich, Andreas; Maak, Steffen. Locus characterization and gene expression of bovine FNDC5: is the myokine irisin relevant in cattle?. Plos One. 9(1):e88060.  PubMed