Anti FNDC5 pAb (ATL-HPA051290)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051290-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FNDC5
Alternative Gene Name: FRCP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001334: 100%, ENSRNOG00000030238: 100%
Entrez Gene ID: 252995
Uniprot ID: Q8NAU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLR |
| Gene Sequence | EDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLR |
| Gene ID - Mouse | ENSMUSG00000001334 |
| Gene ID - Rat | ENSRNOG00000030238 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FNDC5 pAb (ATL-HPA051290) | |
| Datasheet | Anti FNDC5 pAb (ATL-HPA051290) Datasheet (External Link) |
| Vendor Page | Anti FNDC5 pAb (ATL-HPA051290) at Atlas Antibodies |
| Documents & Links for Anti FNDC5 pAb (ATL-HPA051290) | |
| Datasheet | Anti FNDC5 pAb (ATL-HPA051290) Datasheet (External Link) |
| Vendor Page | Anti FNDC5 pAb (ATL-HPA051290) |
| Citations for Anti FNDC5 pAb (ATL-HPA051290) – 1 Found |
| Komolka, Katrin; Albrecht, Elke; Schering, Lisa; Brenmoehl, Julia; Hoeflich, Andreas; Maak, Steffen. Locus characterization and gene expression of bovine FNDC5: is the myokine irisin relevant in cattle?. Plos One. 9(1):e88060. PubMed |