Anti FNBP1L pAb (ATL-HPA065273)

Atlas Antibodies

SKU:
ATL-HPA065273-25
  • Immunohistochemical staining of human uterus shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line SiHa shows localization to cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: formin binding protein 1-like
Gene Name: FNBP1L
Alternative Gene Name: C1orf39, FLJ20275, TOCA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039735: 100%, ENSRNOG00000013798: 100%
Entrez Gene ID: 54874
Uniprot ID: Q5T0N5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPII
Gene Sequence QNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPII
Gene ID - Mouse ENSMUSG00000039735
Gene ID - Rat ENSRNOG00000013798
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FNBP1L pAb (ATL-HPA065273)
Datasheet Anti FNBP1L pAb (ATL-HPA065273) Datasheet (External Link)
Vendor Page Anti FNBP1L pAb (ATL-HPA065273) at Atlas Antibodies

Documents & Links for Anti FNBP1L pAb (ATL-HPA065273)
Datasheet Anti FNBP1L pAb (ATL-HPA065273) Datasheet (External Link)
Vendor Page Anti FNBP1L pAb (ATL-HPA065273)