Anti FN3KRP pAb (ATL-HPA065831)

Atlas Antibodies

SKU:
ATL-HPA065831-25
  • Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: fructosamine 3 kinase related protein
Gene Name: FN3KRP
Alternative Gene Name: FLJ12171, FN3KL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039253: 80%, ENSRNOG00000036660: 83%
Entrez Gene ID: 79672
Uniprot ID: Q9HA64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEMRLKEAGTVGRGGGQEERPFVARFGFDVVTCCGYLPQVNDWQEDWVVFYARQRIQPQMD
Gene Sequence GSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEMRLKEAGTVGRGGGQEERPFVARFGFDVVTCCGYLPQVNDWQEDWVVFYARQRIQPQMD
Gene ID - Mouse ENSMUSG00000039253
Gene ID - Rat ENSRNOG00000036660
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FN3KRP pAb (ATL-HPA065831)
Datasheet Anti FN3KRP pAb (ATL-HPA065831) Datasheet (External Link)
Vendor Page Anti FN3KRP pAb (ATL-HPA065831) at Atlas Antibodies

Documents & Links for Anti FN3KRP pAb (ATL-HPA065831)
Datasheet Anti FN3KRP pAb (ATL-HPA065831) Datasheet (External Link)
Vendor Page Anti FN3KRP pAb (ATL-HPA065831)