Anti FMO4 pAb (ATL-HPA072438)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072438-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FMO4
Alternative Gene Name: FMO2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026692: 68%, ENSRNOG00000003400: 73%
Entrez Gene ID: 2329
Uniprot ID: P31512
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WGYPYNMMVTRRCCSFIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKKAKFIVNDELPNCILCGAITMNTS |
| Gene Sequence | WGYPYNMMVTRRCCSFIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKKAKFIVNDELPNCILCGAITMNTS |
| Gene ID - Mouse | ENSMUSG00000026692 |
| Gene ID - Rat | ENSRNOG00000003400 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FMO4 pAb (ATL-HPA072438) | |
| Datasheet | Anti FMO4 pAb (ATL-HPA072438) Datasheet (External Link) |
| Vendor Page | Anti FMO4 pAb (ATL-HPA072438) at Atlas Antibodies |
| Documents & Links for Anti FMO4 pAb (ATL-HPA072438) | |
| Datasheet | Anti FMO4 pAb (ATL-HPA072438) Datasheet (External Link) |
| Vendor Page | Anti FMO4 pAb (ATL-HPA072438) |