Anti FMO4 pAb (ATL-HPA072438)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072438-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FMO4
Alternative Gene Name: FMO2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026692: 68%, ENSRNOG00000003400: 73%
Entrez Gene ID: 2329
Uniprot ID: P31512
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WGYPYNMMVTRRCCSFIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKKAKFIVNDELPNCILCGAITMNTS |
Gene Sequence | WGYPYNMMVTRRCCSFIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKKAKFIVNDELPNCILCGAITMNTS |
Gene ID - Mouse | ENSMUSG00000026692 |
Gene ID - Rat | ENSRNOG00000003400 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FMO4 pAb (ATL-HPA072438) | |
Datasheet | Anti FMO4 pAb (ATL-HPA072438) Datasheet (External Link) |
Vendor Page | Anti FMO4 pAb (ATL-HPA072438) at Atlas Antibodies |
Documents & Links for Anti FMO4 pAb (ATL-HPA072438) | |
Datasheet | Anti FMO4 pAb (ATL-HPA072438) Datasheet (External Link) |
Vendor Page | Anti FMO4 pAb (ATL-HPA072438) |