Anti FLT4 pAb (ATL-HPA074389)

Atlas Antibodies

SKU: ATL-HPA074389-25

• 

Protein Description: fms related tyrosine kinase 4
Gene Name: FLT4
Alternative Gene Name: PCL, VEGFR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020357: 86%, ENSRNOG00000002511: 86%
Entrez Gene ID: 2324
Uniprot ID: P35916
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YKCVVSNKVGQDERLIYFYVTTIPDGFTIESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHDAHGNPLLLDCK
• Gene Sequence: YKCVVSNKVGQDERLIYFYVTTIPDGFTIESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHDAHGNPLLLDCK
• Gene ID - Mouse: ENSMUSG00000020357
• Gene ID - Rat: ENSRNOG00000002511
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.