Anti FLT4 pAb (ATL-HPA074389)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074389-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FLT4
Alternative Gene Name: PCL, VEGFR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020357: 86%, ENSRNOG00000002511: 86%
Entrez Gene ID: 2324
Uniprot ID: P35916
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YKCVVSNKVGQDERLIYFYVTTIPDGFTIESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHDAHGNPLLLDCK |
| Gene Sequence | YKCVVSNKVGQDERLIYFYVTTIPDGFTIESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHDAHGNPLLLDCK |
| Gene ID - Mouse | ENSMUSG00000020357 |
| Gene ID - Rat | ENSRNOG00000002511 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FLT4 pAb (ATL-HPA074389) | |
| Datasheet | Anti FLT4 pAb (ATL-HPA074389) Datasheet (External Link) |
| Vendor Page | Anti FLT4 pAb (ATL-HPA074389) at Atlas Antibodies |
| Documents & Links for Anti FLT4 pAb (ATL-HPA074389) | |
| Datasheet | Anti FLT4 pAb (ATL-HPA074389) Datasheet (External Link) |
| Vendor Page | Anti FLT4 pAb (ATL-HPA074389) |