Anti FLRT3 pAb (ATL-HPA056033)

Atlas Antibodies

SKU: ATL-HPA056033-25

• 
• 

Protein Description: fibronectin leucine rich transmembrane protein 3
Gene Name: FLRT3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051379: 98%, ENSRNOG00000022428: 53%
Entrez Gene ID: 23767
Uniprot ID: Q9NZU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNHSESSSNRSYRDSGIPDSDHSHS
• Gene Sequence: LEIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNHSESSSNRSYRDSGIPDSDHSHS
• Gene ID - Mouse: ENSMUSG00000051379
• Gene ID - Rat: ENSRNOG00000022428
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.