Anti FLRT3 pAb (ATL-HPA056033)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056033-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FLRT3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051379: 98%, ENSRNOG00000022428: 53%
Entrez Gene ID: 23767
Uniprot ID: Q9NZU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LEIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNHSESSSNRSYRDSGIPDSDHSHS |
Gene Sequence | LEIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNHSESSSNRSYRDSGIPDSDHSHS |
Gene ID - Mouse | ENSMUSG00000051379 |
Gene ID - Rat | ENSRNOG00000022428 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FLRT3 pAb (ATL-HPA056033) | |
Datasheet | Anti FLRT3 pAb (ATL-HPA056033) Datasheet (External Link) |
Vendor Page | Anti FLRT3 pAb (ATL-HPA056033) at Atlas Antibodies |
Documents & Links for Anti FLRT3 pAb (ATL-HPA056033) | |
Datasheet | Anti FLRT3 pAb (ATL-HPA056033) Datasheet (External Link) |
Vendor Page | Anti FLRT3 pAb (ATL-HPA056033) |