Anti FLRT3 pAb (ATL-HPA056033)

Atlas Antibodies

SKU:
ATL-HPA056033-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
  • Immunofluorescent staining of human cell line hTCEpi shows localization to plasma membrane & cell junctions.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: fibronectin leucine rich transmembrane protein 3
Gene Name: FLRT3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051379: 98%, ENSRNOG00000022428: 53%
Entrez Gene ID: 23767
Uniprot ID: Q9NZU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNHSESSSNRSYRDSGIPDSDHSHS
Gene Sequence LEIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNHSESSSNRSYRDSGIPDSDHSHS
Gene ID - Mouse ENSMUSG00000051379
Gene ID - Rat ENSRNOG00000022428
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FLRT3 pAb (ATL-HPA056033)
Datasheet Anti FLRT3 pAb (ATL-HPA056033) Datasheet (External Link)
Vendor Page Anti FLRT3 pAb (ATL-HPA056033) at Atlas Antibodies

Documents & Links for Anti FLRT3 pAb (ATL-HPA056033)
Datasheet Anti FLRT3 pAb (ATL-HPA056033) Datasheet (External Link)
Vendor Page Anti FLRT3 pAb (ATL-HPA056033)