Anti FLRT1 pAb (ATL-HPA054589)

Atlas Antibodies

Catalog No.:
ATL-HPA054589-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: fibronectin leucine rich transmembrane protein 1
Gene Name: FLRT1
Alternative Gene Name: MGC21624, SPG68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047787: 92%, ENSRNOG00000022428: 92%
Entrez Gene ID: 23769
Uniprot ID: Q9NZU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAK
Gene Sequence MAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAK
Gene ID - Mouse ENSMUSG00000047787
Gene ID - Rat ENSRNOG00000022428
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FLRT1 pAb (ATL-HPA054589)
Datasheet Anti FLRT1 pAb (ATL-HPA054589) Datasheet (External Link)
Vendor Page Anti FLRT1 pAb (ATL-HPA054589) at Atlas Antibodies

Documents & Links for Anti FLRT1 pAb (ATL-HPA054589)
Datasheet Anti FLRT1 pAb (ATL-HPA054589) Datasheet (External Link)
Vendor Page Anti FLRT1 pAb (ATL-HPA054589)