Anti FLRT1 pAb (ATL-HPA054589)
Atlas Antibodies
- Catalog No.:
 - ATL-HPA054589-25
 
- Shipping:
 - Calculated at Checkout
 
        
            
        
        
        $303.00
    
         
                            Gene Name: FLRT1
Alternative Gene Name: MGC21624, SPG68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047787: 92%, ENSRNOG00000022428: 92%
Entrez Gene ID: 23769
Uniprot ID: Q9NZU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | MAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAK | 
| Gene Sequence | MAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAK | 
| Gene ID - Mouse | ENSMUSG00000047787 | 
| Gene ID - Rat | ENSRNOG00000022428 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti FLRT1 pAb (ATL-HPA054589) | |
| Datasheet | Anti FLRT1 pAb (ATL-HPA054589) Datasheet (External Link) | 
| Vendor Page | Anti FLRT1 pAb (ATL-HPA054589) at Atlas Antibodies | 
| Documents & Links for Anti FLRT1 pAb (ATL-HPA054589) | |
| Datasheet | Anti FLRT1 pAb (ATL-HPA054589) Datasheet (External Link) | 
| Vendor Page | Anti FLRT1 pAb (ATL-HPA054589) |