Anti FLRT1 pAb (ATL-HPA054589)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054589-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FLRT1
Alternative Gene Name: MGC21624, SPG68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047787: 92%, ENSRNOG00000022428: 92%
Entrez Gene ID: 23769
Uniprot ID: Q9NZU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAK |
| Gene Sequence | MAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAK |
| Gene ID - Mouse | ENSMUSG00000047787 |
| Gene ID - Rat | ENSRNOG00000022428 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FLRT1 pAb (ATL-HPA054589) | |
| Datasheet | Anti FLRT1 pAb (ATL-HPA054589) Datasheet (External Link) |
| Vendor Page | Anti FLRT1 pAb (ATL-HPA054589) at Atlas Antibodies |
| Documents & Links for Anti FLRT1 pAb (ATL-HPA054589) | |
| Datasheet | Anti FLRT1 pAb (ATL-HPA054589) Datasheet (External Link) |
| Vendor Page | Anti FLRT1 pAb (ATL-HPA054589) |