Anti FLOT2 pAb (ATL-HPA071038)

Atlas Antibodies

Catalog No.:
ATL-HPA071038-100
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: flotillin 2
Gene Name: FLOT2
Alternative Gene Name: ECS-1, ECS1, ESA, ESA1, M17S1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061981: 97%, ENSRNOG00000009681: 97%
Entrez Gene ID: 2319
Uniprot ID: Q14254
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQ
Gene Sequence VIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQ
Gene ID - Mouse ENSMUSG00000061981
Gene ID - Rat ENSRNOG00000009681
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FLOT2 pAb (ATL-HPA071038)
Datasheet Anti FLOT2 pAb (ATL-HPA071038) Datasheet (External Link)
Vendor Page Anti FLOT2 pAb (ATL-HPA071038) at Atlas Antibodies

Documents & Links for Anti FLOT2 pAb (ATL-HPA071038)
Datasheet Anti FLOT2 pAb (ATL-HPA071038) Datasheet (External Link)
Vendor Page Anti FLOT2 pAb (ATL-HPA071038)