Anti FLII pAb (ATL-HPA008903)

Atlas Antibodies

SKU:
ATL-HPA008903-25
  • Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & microtubule organizing center.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: flightless I homolog (Drosophila)
Gene Name: FLII
Alternative Gene Name: FLI, Fli1, FLIL, MGC39265
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002812: 95%, ENSRNOG00000004159: 95%
Entrez Gene ID: 2314
Uniprot ID: Q13045
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen YILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEWNEDL
Gene Sequence YILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEWNEDL
Gene ID - Mouse ENSMUSG00000002812
Gene ID - Rat ENSRNOG00000004159
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FLII pAb (ATL-HPA008903)
Datasheet Anti FLII pAb (ATL-HPA008903) Datasheet (External Link)
Vendor Page Anti FLII pAb (ATL-HPA008903) at Atlas Antibodies

Documents & Links for Anti FLII pAb (ATL-HPA008903)
Datasheet Anti FLII pAb (ATL-HPA008903) Datasheet (External Link)
Vendor Page Anti FLII pAb (ATL-HPA008903)