Anti FLI1 pAb (ATL-HPA073099)

Atlas Antibodies

SKU:
ATL-HPA073099-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nuclear bodies.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: Fli-1 proto-oncogene, ETS transcription factor
Gene Name: FLI1
Alternative Gene Name: EWSR2, SIC-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016087: 90%, ENSRNOG00000008904: 87%
Entrez Gene ID: 2313
Uniprot ID: Q01543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SYLRESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNT
Gene Sequence SYLRESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNT
Gene ID - Mouse ENSMUSG00000016087
Gene ID - Rat ENSRNOG00000008904
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FLI1 pAb (ATL-HPA073099)
Datasheet Anti FLI1 pAb (ATL-HPA073099) Datasheet (External Link)
Vendor Page Anti FLI1 pAb (ATL-HPA073099) at Atlas Antibodies

Documents & Links for Anti FLI1 pAb (ATL-HPA073099)
Datasheet Anti FLI1 pAb (ATL-HPA073099) Datasheet (External Link)
Vendor Page Anti FLI1 pAb (ATL-HPA073099)