Anti FLG pAb (ATL-HPA030188 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA030188-25

• 
• 

Protein Description: filaggrin
Gene Name: FLG
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052748: 28%, ENSRNOG00000006241: 27%
Entrez Gene ID: 2312
Uniprot ID: P20930
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKRLSERLEEKEDNEEGVYDYENTGRMTQKWIQSGHIATYYTIQDEAYDTTDSLLEENKIYERSRSSDGKSSSQVNRSRHENTSQVPLQESR
• Gene Sequence: RKRLSERLEEKEDNEEGVYDYENTGRMTQKWIQSGHIATYYTIQDEAYDTTDSLLEENKIYERSRSSDGKSSSQVNRSRHENTSQVPLQESR
• Gene ID - Mouse: ENSMUSG00000052748
• Gene ID - Rat: ENSRNOG00000006241
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FLG pAb (ATL-HPA030188 w/enhanced validation) – 1 Found

Qiu, Tengyang; Teshima, Tathyane H N; Hovorakova, Maria; Tucker, Abigail S. Development of the Vestibular Lamina in Human Embryos: Morphogenesis and Vestibule Formation. Frontiers In Physiology. 11( 32765288):753.