Anti FLCN pAb (ATL-HPA028760)

Atlas Antibodies

SKU:
ATL-HPA028760-25
  • Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: folliculin
Gene Name: FLCN
Alternative Gene Name: BHD, MGC17998, MGC23445
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032633: 97%, ENSRNOG00000003302: 97%
Entrez Gene ID: 201163
Uniprot ID: Q8NFG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGCEDDQSLSKYEFVVTSGSPVAADRVGPTILNKIEAALTNQNLSVDVVDQCLVCLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMTGLSKTYKSHLMSTVR
Gene Sequence VGCEDDQSLSKYEFVVTSGSPVAADRVGPTILNKIEAALTNQNLSVDVVDQCLVCLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMTGLSKTYKSHLMSTVR
Gene ID - Mouse ENSMUSG00000032633
Gene ID - Rat ENSRNOG00000003302
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FLCN pAb (ATL-HPA028760)
Datasheet Anti FLCN pAb (ATL-HPA028760) Datasheet (External Link)
Vendor Page Anti FLCN pAb (ATL-HPA028760) at Atlas Antibodies

Documents & Links for Anti FLCN pAb (ATL-HPA028760)
Datasheet Anti FLCN pAb (ATL-HPA028760) Datasheet (External Link)
Vendor Page Anti FLCN pAb (ATL-HPA028760)