Anti FKRP pAb (ATL-HPA060454)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060454-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: FKRP
Alternative Gene Name: LGMD2I, MDC1C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048920: 100%, ENSRNOG00000016055: 100%
Entrez Gene ID: 79147
Uniprot ID: Q9H9S5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ETARYVVGVLEAAGVRYWLEGGSLLGAARHGDIIPWDYDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWEKAVEGDF |
Gene Sequence | ETARYVVGVLEAAGVRYWLEGGSLLGAARHGDIIPWDYDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWEKAVEGDF |
Gene ID - Mouse | ENSMUSG00000048920 |
Gene ID - Rat | ENSRNOG00000016055 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FKRP pAb (ATL-HPA060454) | |
Datasheet | Anti FKRP pAb (ATL-HPA060454) Datasheet (External Link) |
Vendor Page | Anti FKRP pAb (ATL-HPA060454) at Atlas Antibodies |
Documents & Links for Anti FKRP pAb (ATL-HPA060454) | |
Datasheet | Anti FKRP pAb (ATL-HPA060454) Datasheet (External Link) |
Vendor Page | Anti FKRP pAb (ATL-HPA060454) |