Anti FKRP pAb (ATL-HPA060454)

Atlas Antibodies

Catalog No.:
ATL-HPA060454-100
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: fukutin related protein
Gene Name: FKRP
Alternative Gene Name: LGMD2I, MDC1C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048920: 100%, ENSRNOG00000016055: 100%
Entrez Gene ID: 79147
Uniprot ID: Q9H9S5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETARYVVGVLEAAGVRYWLEGGSLLGAARHGDIIPWDYDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWEKAVEGDF
Gene Sequence ETARYVVGVLEAAGVRYWLEGGSLLGAARHGDIIPWDYDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWEKAVEGDF
Gene ID - Mouse ENSMUSG00000048920
Gene ID - Rat ENSRNOG00000016055
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FKRP pAb (ATL-HPA060454)
Datasheet Anti FKRP pAb (ATL-HPA060454) Datasheet (External Link)
Vendor Page Anti FKRP pAb (ATL-HPA060454) at Atlas Antibodies

Documents & Links for Anti FKRP pAb (ATL-HPA060454)
Datasheet Anti FKRP pAb (ATL-HPA060454) Datasheet (External Link)
Vendor Page Anti FKRP pAb (ATL-HPA060454)