Anti FKBPL pAb (ATL-HPA060158)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060158-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FKBPL
Alternative Gene Name: DIR1, NG7, WISp39
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033739: 76%, ENSRNOG00000000432: 81%
Entrez Gene ID: 63943
Uniprot ID: Q9UIM3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEGWTELTMGVGPWREETWGELIEKCLE |
Gene Sequence | HKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEGWTELTMGVGPWREETWGELIEKCLE |
Gene ID - Mouse | ENSMUSG00000033739 |
Gene ID - Rat | ENSRNOG00000000432 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FKBPL pAb (ATL-HPA060158) | |
Datasheet | Anti FKBPL pAb (ATL-HPA060158) Datasheet (External Link) |
Vendor Page | Anti FKBPL pAb (ATL-HPA060158) at Atlas Antibodies |
Documents & Links for Anti FKBPL pAb (ATL-HPA060158) | |
Datasheet | Anti FKBPL pAb (ATL-HPA060158) Datasheet (External Link) |
Vendor Page | Anti FKBPL pAb (ATL-HPA060158) |