Anti FKBPL pAb (ATL-HPA043478 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA043478-25

• 

Protein Description: FK506 binding protein like
Gene Name: FKBPL
Alternative Gene Name: DIR1, NG7, WISp39
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033739: 88%, ENSRNOG00000000432: 91%
Entrez Gene ID: 63943
Uniprot ID: Q9UIM3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVLHANLAACQLLLGQPQLAAQSCDRVLEREPGHLKALYRRGVAQAALGNLEKATADLKKVLAIDPKNRAAQEELGKVVIQGKNQDAGLAQ
• Gene Sequence: TVLHANLAACQLLLGQPQLAAQSCDRVLEREPGHLKALYRRGVAQAALGNLEKATADLKKVLAIDPKNRAAQEELGKVVIQGKNQDAGLAQ
• Gene ID - Mouse: ENSMUSG00000033739
• Gene ID - Rat: ENSRNOG00000000432
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.