Anti FKBPL pAb (ATL-HPA043478 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA043478-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: FK506 binding protein like
Gene Name: FKBPL
Alternative Gene Name: DIR1, NG7, WISp39
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033739: 88%, ENSRNOG00000000432: 91%
Entrez Gene ID: 63943
Uniprot ID: Q9UIM3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TVLHANLAACQLLLGQPQLAAQSCDRVLEREPGHLKALYRRGVAQAALGNLEKATADLKKVLAIDPKNRAAQEELGKVVIQGKNQDAGLAQ
Gene Sequence TVLHANLAACQLLLGQPQLAAQSCDRVLEREPGHLKALYRRGVAQAALGNLEKATADLKKVLAIDPKNRAAQEELGKVVIQGKNQDAGLAQ
Gene ID - Mouse ENSMUSG00000033739
Gene ID - Rat ENSRNOG00000000432
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FKBPL pAb (ATL-HPA043478 w/enhanced validation)
Datasheet Anti FKBPL pAb (ATL-HPA043478 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FKBPL pAb (ATL-HPA043478 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FKBPL pAb (ATL-HPA043478 w/enhanced validation)
Datasheet Anti FKBPL pAb (ATL-HPA043478 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FKBPL pAb (ATL-HPA043478 w/enhanced validation)