Anti FKBP10 pAb (ATL-HPA057021 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA057021-25

• 
• 

Protein Description: FK506 binding protein 10, 65 kDa
Gene Name: FKBP10
Alternative Gene Name: FKBP6, FLJ20683, FLJ22041, FLJ23833, hFKBP65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001555: 87%, ENSRNOG00000015941: 88%
Entrez Gene ID: 60681
Uniprot ID: Q96AY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLPTGYLFVWHKDPPANLFEDMDLNKDGEVPPEEFSTFIKAQVSEGKGRLMPGQDPEKTIGDMFQNQDRNQDGKITV
• Gene Sequence: GLPTGYLFVWHKDPPANLFEDMDLNKDGEVPPEEFSTFIKAQVSEGKGRLMPGQDPEKTIGDMFQNQDRNQDGKITV
• Gene ID - Mouse: ENSMUSG00000001555
• Gene ID - Rat: ENSRNOG00000015941
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FKBP10 pAb (ATL-HPA057021 w/enhanced validation) – 1 Found

Liang, Liang; Zhao, Kun; Zhu, Jin-Hui; Chen, Gang; Qin, Xin-Gan; Chen, Jun-Qiang. Comprehensive evaluation of FKBP10 expression and its prognostic potential in gastric cancer. Oncology Reports. 2019;42(2):615-628.