Anti FIGLA pAb (ATL-HPA071241)

Atlas Antibodies

SKU:
ATL-HPA071241-25
  • Immunohistochemical staining of human ovary shows moderate nuclear positivity in follicle cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: folliculogenesis specific bHLH transcription factor
Gene Name: FIGLA
Alternative Gene Name: bHLHc8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030001: 51%, ENSRNOG00000015877: 50%
Entrez Gene ID: 344018
Uniprot ID: Q6QHK4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDLLEGAKDSKKQDPDEQSYSNNSSESHTSSARQLSRNITQHISCAFGLKN
Gene Sequence SDLLEGAKDSKKQDPDEQSYSNNSSESHTSSARQLSRNITQHISCAFGLKN
Gene ID - Mouse ENSMUSG00000030001
Gene ID - Rat ENSRNOG00000015877
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FIGLA pAb (ATL-HPA071241)
Datasheet Anti FIGLA pAb (ATL-HPA071241) Datasheet (External Link)
Vendor Page Anti FIGLA pAb (ATL-HPA071241) at Atlas Antibodies

Documents & Links for Anti FIGLA pAb (ATL-HPA071241)
Datasheet Anti FIGLA pAb (ATL-HPA071241) Datasheet (External Link)
Vendor Page Anti FIGLA pAb (ATL-HPA071241)